PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0917s0046.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family ZF-HD
Protein Properties Length: 290aa    MW: 32032.5 Da    PI: 6.414
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0917s0046.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.89.4e-3273126357
          ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                          ++r++eClkN+A+++GghavDGCgEfmp+ g egt++alkCaACgCHRnFHR+e 
  Cagra.0917s0046.1.p  73 RFRFRECLKNQAVNIGGHAVDGCGEFMPA-GIEGTIDALKCAACGCHRNFHRKEL 126
                          789*************************9.999********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.5E-2874125IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.5E-2975125IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-2475126IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.41576125IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE patternPS000280112136IPR007087Zinc finger, C2H2
Gene3DG3DSA:1.10.10.608.3E-31185257IPR009057Homeodomain-like
SuperFamilySSF466891.18E-18185257IPR009057Homeodomain-like
TIGRFAMsTIGR015657.1E-26196252IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0010431Biological Processseed maturation
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MEFEDNNNNN NEEEQEDDMN LHEEEEEDDA VYDSPPLSRG VVKASTESHE TTGTTSTGGG  60
GGFMVVHGGG GSRFRFRECL KNQAVNIGGH AVDGCGEFMP AGIEGTIDAL KCAACGCHRN  120
FHRKELPYFH HAPPQHQAPP PPPPGFYRLP APVSYRPPPS QAPPLQLALP PPQRERSEDP  180
METSSAEAGG GGGGIRKRFR TKFTAEQKER MLALAERIGW RIQRQDDEVI QRFCQETGVP  240
RQVLKVWLHN NKHTLGKSPP PLLHHHHHQP PPTTTTAPQS SFHHEQDQP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A2e-351952541675ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00588DAPTransfer from AT5G65410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0114790.0AB011479.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MNA5.
GenBankBT0023850.0BT002385.1 Arabidopsis thaliana putative protein (At5g65410) mRNA, complete cds.
GenBankBT0063040.0BT006304.1 Arabidopsis thaliana At5g65410 mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002864955.11e-144hypothetical protein ARALYDRAFT_919872
SwissprotQ9FKP81e-143ZHD1_ARATH; Zinc-finger homeodomain protein 1
TrEMBLD7MTX91e-144D7MTX9_ARALL; Putative uncharacterized protein
STRINGscaffold_803272.11e-143(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM132371728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65410.11e-106homeobox protein 25